APELIN-36 (HUMAN)
|
- $100 - $2320
- Product name: APELIN-36 (HUMAN)
- CAS: 252642-12-9
- MF: C184H295N69O42R2S
- MW: 4177.8132
- EINECS:
- MDL Number:MFCD01865608
- Synonyms:M.W. 4195.83 C184H297N69O43S;L-Leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginylglycyl-L-seryl-L-arginyl-L-asparaginylglycyl-L-prolylglycyl-L-prolyl-L-tryptophyl-L-glutaminylglycylglycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysylglycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine;Apelin (human);LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH;LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE;APELIN-36 (HUMAN);Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
37 prices
Selected condition:
Brand
- aablocks
- ApexBio Technology
- Arctom
- Biosynth
- Cayman Chemical
- ChemScene
- Thermo Scientific Chemicals
- Tocris
- Usbiological
Package
- 0.1mg
- 100ug
- 250ug
- 500ug
- 0.5mg
- 500μg
- 1
- 1mg
- 1000ug
- 2mg
- 2000ug
- 5mg
- 10mg
- 25mg
- 100mg
- Manufactureraablocks
- Product numberAA0039UZ
- Product descriptionApelin 36 ≥98%
- Packaging1mg
- Price$100
- Updated2026-05-28
- Buy
- Manufactureraablocks
- Product numberAA0039UZ
- Product descriptionApelin 36 ≥98%
- Packaging5mg
- Price$343
- Updated2026-05-28
- Buy
- Manufactureraablocks
- Product numberAA0039UZ
- Product descriptionApelin 36 ≥98%
- Packaging25mg
- Price$1143
- Updated2026-05-28
- Buy
- ManufacturerApexBio Technology
- Product numberB5303
- Product descriptionApelin-36, human
- Packaging1mg
- Price$692
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB5303
- Product descriptionApelin-36 (human)
- Packaging1mg
- Price$501
- Updated2026-05-06
- Buy
- ManufacturerArctom
- Product numberHY-P1064
- Product descriptionApelin-36(human) 98.01%
- Packaging1mg
- Price$352
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1064
- Product descriptionApelin-36(human) 98.01%
- Packaging5mg
- Price$1425
- Updated2026-05-26
- Buy
- ManufacturerBiosynth
- Product numberFA109395
- Product descriptionApelin-36 (human)
- Packaging2000ug
- Price$2320
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFA109395
- Product descriptionApelin-36 (human)
- Packaging1000ug
- Price$1330
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPA16915
- Product descriptionApelin-36, human
- Packaging100mg
- Price$1518
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPP49914
- Product descriptionH-LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH
- Packaging100mg
- Price$1605
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFA109395
- Product descriptionApelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
- Packaging2mg
- Price$1290.44
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFA109395
- Product descriptionApelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
- Packaging1mg
- Price$742
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberCRB1000048
- Product descriptionApelin-36 Human
- Packaging1mg
- Price$453.57
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFA109395
- Product descriptionApelin-36 (human)
- Packaging100ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFA109395
- Product descriptionApelin-36 (human)
- Packaging250ug
- Price$900
- Updated2026-06-04
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA0039UZ | Apelin 36 ≥98% | 1mg | $100 | 2026-05-28 | Buy |
| aablocks | AA0039UZ | Apelin 36 ≥98% | 5mg | $343 | 2026-05-28 | Buy |
| aablocks | AA0039UZ | Apelin 36 ≥98% | 25mg | $1143 | 2026-05-28 | Buy |
| ApexBio Technology | B5303 | Apelin-36, human | 1mg | $692 | 2021-12-16 | Buy |
| ApexBio Technology | B5303 | Apelin-36 (human) | 1mg | $501 | 2026-05-06 | Buy |
| Arctom | HY-P1064 | Apelin-36(human) 98.01% | 1mg | $352 | 2026-05-26 | Buy |
| Arctom | HY-P1064 | Apelin-36(human) 98.01% | 5mg | $1425 | 2026-05-26 | Buy |
| Biosynth | FA109395 | Apelin-36 (human) | 2000ug | $2320 | 2026-06-04 | Buy |
| Biosynth | FA109395 | Apelin-36 (human) | 1000ug | $1330 | 2026-06-04 | Buy |
| Biosynth | PA16915 | Apelin-36, human | 100mg | $1518 | 2026-06-04 | Buy |
| Biosynth | PP49914 | H-LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH | 100mg | $1605 | 2026-06-04 | Buy |
| Biosynth | FA109395 | Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH | 2mg | $1290.44 | 2021-12-16 | Buy |
| Biosynth | FA109395 | Apelin-36 (human) H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH | 1mg | $742 | 2021-12-16 | Buy |
| Biosynth | CRB1000048 | Apelin-36 Human | 1mg | $453.57 | 2026-06-04 | Buy |
| Biosynth | FA109395 | Apelin-36 (human) | 100ug | $900 | 2026-06-04 | Buy |
| Biosynth | FA109395 | Apelin-36 (human) | 250ug | $900 | 2026-06-04 | Buy |
Properties
storage temp. :-15°C
solubility :DMF: 30 mg/ml; DMSO: 30 mg/ml; Ethanol: 10 mg/ml; PBS (pH 7.2): 10 mg/ml
form :Lyophilized powder
color :White to off-white
Water Solubility :Soluble in water at 1mg/ml
Sequence :Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe
solubility :DMF: 30 mg/ml; DMSO: 30 mg/ml; Ethanol: 10 mg/ml; PBS (pH 7.2): 10 mg/ml
form :Lyophilized powder
color :White to off-white
Water Solubility :Soluble in water at 1mg/ml
Sequence :Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
The apelin gene encodes a preproprotein that is processed to generate a variety of bioactive peptides, including those having 36, 17, or 13 amino acids (apelin-36, apelin-17, and apelin-13, respectively). The apelin proteins are the endogenous ligands of the G protein-coupled receptor, APJ. Apelin-36 is the full-length mature peptide produced from the translated 77 amino acid prepropeptide. The apelins act primarily in the peripheral and central nervous system, playing important roles in regulating cardiovascular function, fluid homeostasis, hypertension, and insulin sensitivity. Apelin-36 is a less potent agonist of APJ than either apelin-17 or apelin-13 (EC50 = 20, 2.5, and 0.37 nM, respectively). Apelin-36 potently inhibits HIV-1 entry into cells expressing APJ and CD4, limiting HIV infection.Related product price
-
spinorphin
$53.58-1044 -
GALANIN, HUMAN
$133-1733 -
Ferric acetylacetonate
$5-2359.48




