GALANIN, HUMAN
|
- $133 - $1733
- Product name: GALANIN, HUMAN
- CAS: 119418-04-1
- MF: C139H210N42O43
- MW: 3157.41
- EINECS:
- MDL Number:MFCD00135986
- Synonyms:H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER-OH;GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS;GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-VAL-GLY-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-ASN-GLY-LEU-THR-SER;GALANIN, HUMAN;GALANIN (1-30) (HUMAN);M.W. 3157.41 C139H210N42O43;GALANIN, HUMANGALANIN;Galanin, people
27 prices
Selected condition:
Brand
- aablocks
- American Custom Chemicals Corporation
- ApexBio Technology
- Arctom
- Biosynth
- ChemScene
- Sigma-Aldrich
- Thermo Scientific Chemicals
- Tocris
Package
- 0.1mg
- 500ug
- 1
- 0.5MG
- 1mg
- 5mg
- 500??g
- Manufactureraablocks
- Product numberAA008QZF
- Product descriptionGalanin (1-30) (human) ≥97%(HPLC)
- Packaging1mg
- Price$260
- Updated2026-05-28
- Buy
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0001385
- Product descriptionGALANIN 95.00%
- Packaging0.5MG
- Price$664.13
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB6624
- Product descriptionGalanin (1-30) (human)
- Packaging5mg
- Price$1365
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberB6624
- Product descriptionGalanin(1-30)(human)
- Packaging5mg
- Price$1733
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB6624
- Product descriptionGalanin(1-30)(human)
- Packaging500ug
- Price$268
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB6624
- Product descriptionGalanin (1-30) (human)
- Packaging1mg
- Price$365
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberB6624
- Product descriptionGalanin(1-30)(human)
- Packaging1mg
- Price$441
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB6624
- Product descriptionGalanin (1-30) (human)
- Packaging500ug
- Price$210
- Updated2026-05-06
- Buy
- ManufacturerArctom
- Product numberHY-P1127
- Product descriptionGalanin (1-30), human 99.91%
- Packaging1mg
- Price$228
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1127
- Product descriptionGalanin (1-30), human 99.91%
- Packaging500??g
- Price$133
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1127
- Product descriptionGalanin (1-30), human 99.91%
- Packaging5mg
- Price$893
- Updated2026-05-26
- Buy
- ManufacturerBiosynth
- Product numberFG110297
- Product descriptionGalanin (human) trifluoroacetate salt
- Packaging0.5mg
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPGA-4245-V
- Product descriptionGalanin (Human)
- Packaging0.5mg
- Price$1485.77
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFG110297
- Product descriptionGalanin (human) trifluoroacetate salt
- Packaging1mg
- Price$1529.17
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberCRB1000200
- Product descriptionGalanin Human
- Packaging0.5mg
- Price$226.79
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberCRB1000200
- Product descriptionGalanin Human
- Packaging1mg
- Price$331.46
- Updated2026-06-04
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA008QZF | Galanin (1-30) (human) ≥97%(HPLC) | 1mg | $260 | 2026-05-28 | Buy |
| American Custom Chemicals Corporation | PEP0001385 | GALANIN 95.00% | 0.5MG | $664.13 | 2021-12-16 | Buy |
| ApexBio Technology | B6624 | Galanin (1-30) (human) | 5mg | $1365 | 2026-05-06 | Buy |
| ApexBio Technology | B6624 | Galanin(1-30)(human) | 5mg | $1733 | 2021-12-16 | Buy |
| ApexBio Technology | B6624 | Galanin(1-30)(human) | 500ug | $268 | 2021-12-16 | Buy |
| ApexBio Technology | B6624 | Galanin (1-30) (human) | 1mg | $365 | 2026-05-06 | Buy |
| ApexBio Technology | B6624 | Galanin(1-30)(human) | 1mg | $441 | 2021-12-16 | Buy |
| ApexBio Technology | B6624 | Galanin (1-30) (human) | 500ug | $210 | 2026-05-06 | Buy |
| Arctom | HY-P1127 | Galanin (1-30), human 99.91% | 1mg | $228 | 2026-05-26 | Buy |
| Arctom | HY-P1127 | Galanin (1-30), human 99.91% | 500??g | $133 | 2026-05-26 | Buy |
| Arctom | HY-P1127 | Galanin (1-30), human 99.91% | 5mg | $893 | 2026-05-26 | Buy |
| Biosynth | FG110297 | Galanin (human) trifluoroacetate salt | 0.5mg | $900 | 2026-06-04 | Buy |
| Biosynth | PGA-4245-V | Galanin (Human) | 0.5mg | $1485.77 | 2026-06-04 | Buy |
| Biosynth | FG110297 | Galanin (human) trifluoroacetate salt | 1mg | $1529.17 | 2026-06-04 | Buy |
| Biosynth | CRB1000200 | Galanin Human | 0.5mg | $226.79 | 2026-06-04 | Buy |
| Biosynth | CRB1000200 | Galanin Human | 1mg | $331.46 | 2026-06-04 | Buy |
Properties
storage temp. :−20°C
form :powder
color :White
Water Solubility :Soluble to 0.50 mg/ml in water
Sequence :Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser
InChIKey :CBSXZYWGVAQSHI-RUKUCZSXSA-N
form :powder
color :White
Water Solubility :Soluble to 0.50 mg/ml in water
Sequence :Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser
InChIKey :CBSXZYWGVAQSHI-RUKUCZSXSA-N
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Galanin human has been used in immunohistochemistry performed on ileums of pigs to study the effect of the mycotoxin zearalenone on the expression of intestinal peptides.Related product price
-
spinorphin
$53.58-1044 -
APELIN-36 (HUMAN)
$100-2320 -
367518-31-8
$79.9-2382.25
Suppliers and manufacturers
Wuhan Fortuna Chemical Co., Ltd
Shenzhen Nexconn Pharmatechs Ltd
Cellmano Biotech Limited
Dideu Industries Group Limited
BOC Sciences
Hangzhou Go Top Peptide Biotech
Chengdu Youngshe Chemical Co., Ltd.
Nanjing TGpeptide
Shanghai Acmec Biochemical Technology Co., Ltd.
Galanin
CAS:119418-04-1




