GLP-2 (HUMAN)
|
- $180 - $5880
- Product name: GLP-2 (HUMAN)
- CAS: 223460-79-5
- MF: C165H254N44O55S
- MW: 3766.10906
- EINECS:
- MDL Number:MFCD00081649
- Synonyms:PREPROGLUCAGON (146-179) (HUMAN) TRIFLUOROACETATE SALT;PREPROGLUCAGON (126-159) (HUMAN);PREPROGLUCAGON (146-178) (HUMAN);HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP;H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-ARG-OH;H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-ALA-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLAARDFINWLIQTKITDR;GLP-2 (1-33) (HUMAN)
32 prices
Selected condition：
Brand
- aablocks
- ApexBio Technology
- Arctom
- Biosynth
- ChemScene
- Tocris
- Usbiological
Package
- 0.5mg
- 500ug
- 1mg
- 1
- 1000ug
- 2000ug
- 5mg
- 5000ug
- 10mg
- 10000ug
- 25mg
- 50mg
- 200ul
- 48Tests
- 96Tests
- 500??g
- Manufactureraablocks
- Product numberAA01EAKD
- Product descriptionGlp-2(1-33)(Human) ≥98%
- Packaging1mg
- Price$320
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAKD
- Product descriptionGlp-2(1-33)(Human) ≥98%
- Packaging5mg
- Price$1337
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAKD
- Product descriptionGlp-2(1-33)(Human) ≥98%
- Packaging10mg
- Price$2058
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAKD
- Product descriptionGlp-2(1-33)(Human) ≥98%
- Packaging25mg
- Price$4200
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAKD
- Product descriptionGlp-2(1-33)(Human) ≥98%
- Packaging50mg
- Price$5880
- Updated2026-05-30
- Buy
- ManufacturerApexBio Technology
- Product numberB5281
- Product descriptionGLP-2 (human)
- Packaging5mg
- Price$1480
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberB5281
- Product descriptionGLP-2 (human)
- Packaging500ug
- Price$233
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberB5281
- Product descriptionGLP-2 (human)
- Packaging1mg
- Price$389
- Updated2026-05-06
- Buy
- ManufacturerArctom
- Product numberHY-P1024
- Product descriptionGLP-2(1-33)(human) 98.24%
- Packaging500??g
- Price$210
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1024
- Product descriptionGLP-2(1-33)(human) 98.24%
- Packaging1mg
- Price$350
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1024
- Product descriptionGLP-2(1-33)(human) 98.24%
- Packaging5mg
- Price$1048
- Updated2026-05-26
- Buy
- ManufacturerBiosynth
- Product numberVAC-00464
- Product descriptionGLP-2 (1-33) (human)
- Packaging5mg
- Price$1107.1
- Updated2026-06-05
- Buy
- ManufacturerBiosynth
- Product numberFG110245
- Product descriptionGLP-2 (1-33) (human) ammonium acetate salt
- Packaging2000ug
- Price$1020
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPGL-4376-V
- Product descriptionGlucagon-like Peptide 2 (Human)
- Packaging0.5mg
- Price$1306.72
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberVAC-00464
- Product descriptionGLP-2 (1-33) (human)
- Packaging10mg
- Price$1845.3
- Updated2026-06-05
- Buy
- ManufacturerBiosynth
- Product numberFG110245
- Product descriptionGLP-2 (1-33) (human) ammonium acetate salt
- Packaging5000ug
- Price$2200
- Updated2026-06-04
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA01EAKD | Glp-2(1-33)(Human) ≥98% | 1mg | $320 | 2026-05-30 | Buy |
| aablocks | AA01EAKD | Glp-2(1-33)(Human) ≥98% | 5mg | $1337 | 2026-05-30 | Buy |
| aablocks | AA01EAKD | Glp-2(1-33)(Human) ≥98% | 10mg | $2058 | 2026-05-30 | Buy |
| aablocks | AA01EAKD | Glp-2(1-33)(Human) ≥98% | 25mg | $4200 | 2026-05-30 | Buy |
| aablocks | AA01EAKD | Glp-2(1-33)(Human) ≥98% | 50mg | $5880 | 2026-05-30 | Buy |
| ApexBio Technology | B5281 | GLP-2 (human) | 5mg | $1480 | 2026-05-06 | Buy |
| ApexBio Technology | B5281 | GLP-2 (human) | 500ug | $233 | 2026-05-06 | Buy |
| ApexBio Technology | B5281 | GLP-2 (human) | 1mg | $389 | 2026-05-06 | Buy |
| Arctom | HY-P1024 | GLP-2(1-33)(human) 98.24% | 500??g | $210 | 2026-05-26 | Buy |
| Arctom | HY-P1024 | GLP-2(1-33)(human) 98.24% | 1mg | $350 | 2026-05-26 | Buy |
| Arctom | HY-P1024 | GLP-2(1-33)(human) 98.24% | 5mg | $1048 | 2026-05-26 | Buy |
| Biosynth | VAC-00464 | GLP-2 (1-33) (human) | 5mg | $1107.1 | 2026-06-05 | Buy |
| Biosynth | FG110245 | GLP-2 (1-33) (human) ammonium acetate salt | 2000ug | $1020 | 2026-06-04 | Buy |
| Biosynth | PGL-4376-V | Glucagon-like Peptide 2 (Human) | 0.5mg | $1306.72 | 2026-06-04 | Buy |
| Biosynth | VAC-00464 | GLP-2 (1-33) (human) | 10mg | $1845.3 | 2026-06-05 | Buy |
| Biosynth | FG110245 | GLP-2 (1-33) (human) ammonium acetate salt | 5000ug | $2200 | 2026-06-04 | Buy |
Properties
storage temp. :−20°C
solubility :Soluble to 1 mg/ml in 5% NH4OH / water
form :solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in 5% NH4OH / water
Sequence :H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
solubility :Soluble to 1 mg/ml in 5% NH4OH / water
form :solid
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in 5% NH4OH / water
Sequence :H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
GLP-2 is cosecreted with GLP-1 in response to nutrient ingestion. The principal role of GLP-2 appears to be the maintenance of the growth and absorptive function of the intestinal mucosal villus epithelium. GLP-2 was first identified as a novel peptide following the cloning of the proglucagon gene in the early 1980s, and subsequently the biosynthesis and release of GLP-2 were confirmed by isolation and characterization from the porcine and human small intestine. The biological role of GLP-2 as a stimulator of intestinal epithelial proliferation was first demonstrated in 1996.Related product price
-
Ethyl isocyanoacetate
$12.7-1687 -
COBALT(II) ACETYLACETONATE
$43-1161 -
METHYL ISOCYANOACETATE
$19-1275
