Teriparatide acetate
|
- $88 - $5690
- Product name: Teriparatide acetate
- CAS: 52232-67-4
- MF: C172H278N52O47S2
- MW: 3890.49792
- EINECS:640-978-1
- MDL Number:MFCD00149013
- Synonyms:PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN;Pth(1-34)(human) Acetate
74 prices
Selected condition：
Brand
- aablocks
- American Custom Chemicals Corporation
- ApexBio Technology
- Arctom
- Biosynth
- Chemenu
- ChemScene
- Crysdot
- DC Chemicals
- Medical Isotopes, Inc.
- Sigma-Aldrich
- Thermo Scientific Chemicals
- Tocris
- TRC
- Usbiological
Package
- 23-5501-1mg
- 0.5mg
- 1mg
- Y0001916
- 0.1mg
- 1
- Y0001895
- 2mg
- 5mg
- 10mg
- 25mg
- 50mg
- 100mg
- 250mg
- 1g
- 1 mg
- 1.3 mg
- Manufactureraablocks
- Product numberAA01CBX8
- Product descriptionTeriparatide >98%
- Packaging1mg
- Price$182
- Updated2026-05-29
- Buy
- Manufactureraablocks
- Product numberAA01CBX8
- Product descriptionTeriparatide >98%
- Packaging10mg
- Price$343
- Updated2026-05-29
- Buy
- Manufactureraablocks
- Product numberAA01CBX8
- Product descriptionTeriparatide >98%
- Packaging5mg
- Price$255
- Updated2026-05-29
- Buy
- Manufactureraablocks
- Product numberAA01CBX8
- Product descriptionTeriparatide >98%
- Packaging50mg
- Price$651
- Updated2026-05-29
- Buy
- Manufactureraablocks
- Product numberAA01CBX8
- Product descriptionTeriparatide >98%
- Packaging100mg
- Price$944
- Updated2026-05-29
- Buy
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberSHG0006488
- Product descriptionPARATHYROID HORMONE (1-34) 95.00%
- Packaging1MG
- Price$883.11
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid hormone (1-34) (human)
- Packaging10mg
- Price$163
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging25mg
- Price$375
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid hormone (1-34) (human)
- Packaging25mg
- Price$344
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging1mg
- Price$88
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid hormone (1-34) (human)
- Packaging1mg
- Price$97
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging5mg
- Price$132
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid hormone (1-34) (human)
- Packaging5mg
- Price$119
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging10mg
- Price$167
- Updated2021-12-16
- Buy
- ManufacturerArctom
- Product numberHY-P0059
- Product descriptionTeriparatide 99.98%
- Packaging5mg
- Price$189
- Updated2026-05-25
- Buy
- ManufacturerArctom
- Product numberHY-P0059
- Product descriptionTeriparatide 99.98%
- Packaging5mg
- Price$189
- Updated2026-05-26
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA01CBX8 | Teriparatide >98% | 1mg | $182 | 2026-05-29 | Buy |
| aablocks | AA01CBX8 | Teriparatide >98% | 10mg | $343 | 2026-05-29 | Buy |
| aablocks | AA01CBX8 | Teriparatide >98% | 5mg | $255 | 2026-05-29 | Buy |
| aablocks | AA01CBX8 | Teriparatide >98% | 50mg | $651 | 2026-05-29 | Buy |
| aablocks | AA01CBX8 | Teriparatide >98% | 100mg | $944 | 2026-05-29 | Buy |
| American Custom Chemicals Corporation | SHG0006488 | PARATHYROID HORMONE (1-34) 95.00% | 1MG | $883.11 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid hormone (1-34) (human) | 10mg | $163 | 2026-05-06 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 25mg | $375 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid hormone (1-34) (human) | 25mg | $344 | 2026-05-06 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 1mg | $88 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid hormone (1-34) (human) | 1mg | $97 | 2026-05-06 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 5mg | $132 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid hormone (1-34) (human) | 5mg | $119 | 2026-05-06 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 10mg | $167 | 2021-12-16 | Buy |
| Arctom | HY-P0059 | Teriparatide 99.98% | 5mg | $189 | 2026-05-25 | Buy |
| Arctom | HY-P0059 | Teriparatide 99.98% | 5mg | $189 | 2026-05-26 | Buy |
Properties
Melting point :>205oC (dec.)
RTECS :SQ7770000
storage temp. :−20°C
solubility :DMSO (Slightly), Water (Slightly)
form :powder
color :White to Off-White
biological source :human
Water Solubility :Soluble to 0.40 mg/ml in water
Sequence :H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability :Hygroscopic
InChIKey :BUUKFBVDKSFMHN-LKMAISLMSA-N
CAS DataBase Reference :52232-67-4(CAS DataBase Reference)
RTECS :SQ7770000
storage temp. :−20°C
solubility :DMSO (Slightly), Water (Slightly)
form :powder
color :White to Off-White
biological source :human
Water Solubility :Soluble to 0.40 mg/ml in water
Sequence :H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability :Hygroscopic
InChIKey :BUUKFBVDKSFMHN-LKMAISLMSA-N
CAS DataBase Reference :52232-67-4(CAS DataBase Reference)
Safety Information
| Symbol(GHS): |
|
|||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal word: | Warning | |||||||||||||||||||||
| Hazard statements: |
|
|||||||||||||||||||||
| Precautionary statements: |
|
Description
A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.Related product price
-
Oxytocin
$27.4-2395.3 -
Melanotan II
$35-3154.84 -
Cosyntropin
$71.8-1360
Suppliers and manufacturers
Shaanxi TNJONE Pharmaceutical Co., Ltd
Sea Biological Co.,LTD
Cellmano Biotech Limited
Rixing Chemical CO.,LTD.
Yiwu Fengjin Commercial Company
HUARONG(GUANGDONG) PHARMACEUTICAL CO.,LTD
Hydebio Labs Co.,Limited
Teriparatide acetate
CAS:52232-67-4
