Teriparatide acetate
|
- $88 - $5690
- Product name: Teriparatide acetate
- CAS: 52232-67-4
- MF: C172H278N52O47S2
- MW: 3890.49792
- EINECS:640-978-1
- MDL Number:MFCD00149013
- Synonyms:PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN;Pth(1-34)(human) Acetate
74 prices
Selected condition:
Brand
- aablocks
- American Custom Chemicals Corporation
- ApexBio Technology
- Arctom
- Biosynth
- Chemenu
- ChemScene
- Crysdot
- DC Chemicals
- Medical Isotopes, Inc.
- Sigma-Aldrich
- Thermo Scientific Chemicals
- Tocris
- TRC
- Usbiological
Package
- Y0001895
- 0.5mg
- 1mg
- 2mg
- 1
- 0.1mg
- 23-5501-1mg
- Y0001916
- 5mg
- 10mg
- 25mg
- 50mg
- 100mg
- 250mg
- 1g
- 1 mg
- 1.3 mg
- Manufactureraablocks
- Product numberAA01CBX8
- Product descriptionTeriparatide >98%
- Packaging1mg
- Price$182
- Updated2026-05-29
- Buy
- Manufactureraablocks
- Product numberAA01CBX8
- Product descriptionTeriparatide >98%
- Packaging5mg
- Price$255
- Updated2026-05-29
- Buy
- Manufactureraablocks
- Product numberAA01CBX8
- Product descriptionTeriparatide >98%
- Packaging10mg
- Price$343
- Updated2026-05-29
- Buy
- Manufactureraablocks
- Product numberAA01CBX8
- Product descriptionTeriparatide >98%
- Packaging50mg
- Price$651
- Updated2026-05-29
- Buy
- Manufactureraablocks
- Product numberAA01CBX8
- Product descriptionTeriparatide >98%
- Packaging100mg
- Price$944
- Updated2026-05-29
- Buy
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberSHG0006488
- Product descriptionPARATHYROID HORMONE (1-34) 95.00%
- Packaging1MG
- Price$883.11
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging25mg
- Price$375
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid hormone (1-34) (human)
- Packaging25mg
- Price$344
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging10mg
- Price$167
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid hormone (1-34) (human)
- Packaging10mg
- Price$163
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging1mg
- Price$88
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid hormone (1-34) (human)
- Packaging1mg
- Price$97
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid hormone (1-34) (human)
- Packaging5mg
- Price$119
- Updated2026-05-06
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging5mg
- Price$132
- Updated2021-12-16
- Buy
- ManufacturerArctom
- Product numberHY-P0059
- Product descriptionTeriparatide 99.98%
- Packaging1mg
- Price$126
- Updated2026-05-25
- Buy
- ManufacturerArctom
- Product numberHY-P0059
- Product descriptionTeriparatide 99.98%
- Packaging1mg
- Price$126
- Updated2026-05-26
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA01CBX8 | Teriparatide >98% | 1mg | $182 | 2026-05-29 | Buy |
| aablocks | AA01CBX8 | Teriparatide >98% | 5mg | $255 | 2026-05-29 | Buy |
| aablocks | AA01CBX8 | Teriparatide >98% | 10mg | $343 | 2026-05-29 | Buy |
| aablocks | AA01CBX8 | Teriparatide >98% | 50mg | $651 | 2026-05-29 | Buy |
| aablocks | AA01CBX8 | Teriparatide >98% | 100mg | $944 | 2026-05-29 | Buy |
| American Custom Chemicals Corporation | SHG0006488 | PARATHYROID HORMONE (1-34) 95.00% | 1MG | $883.11 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 25mg | $375 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid hormone (1-34) (human) | 25mg | $344 | 2026-05-06 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 10mg | $167 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid hormone (1-34) (human) | 10mg | $163 | 2026-05-06 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 1mg | $88 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid hormone (1-34) (human) | 1mg | $97 | 2026-05-06 | Buy |
| ApexBio Technology | A1129 | Parathyroid hormone (1-34) (human) | 5mg | $119 | 2026-05-06 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 5mg | $132 | 2021-12-16 | Buy |
| Arctom | HY-P0059 | Teriparatide 99.98% | 1mg | $126 | 2026-05-25 | Buy |
| Arctom | HY-P0059 | Teriparatide 99.98% | 1mg | $126 | 2026-05-26 | Buy |
Properties
Melting point :>205oC (dec.)
RTECS :SQ7770000
storage temp. :−20°C
solubility :DMSO (Slightly), Water (Slightly)
form :powder
color :White to Off-White
biological source :human
Water Solubility :Soluble to 0.40 mg/ml in water
Sequence :H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability :Hygroscopic
InChIKey :BUUKFBVDKSFMHN-LKMAISLMSA-N
CAS DataBase Reference :52232-67-4(CAS DataBase Reference)
RTECS :SQ7770000
storage temp. :−20°C
solubility :DMSO (Slightly), Water (Slightly)
form :powder
color :White to Off-White
biological source :human
Water Solubility :Soluble to 0.40 mg/ml in water
Sequence :H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability :Hygroscopic
InChIKey :BUUKFBVDKSFMHN-LKMAISLMSA-N
CAS DataBase Reference :52232-67-4(CAS DataBase Reference)
Safety Information
| Symbol(GHS): |
|
|||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal word: | Warning | |||||||||||||||||||||
| Hazard statements: |
|
|||||||||||||||||||||
| Precautionary statements: |
|
Description
A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.Related product price
-
Oxytocin
$27.4-2395.3 -
Melanotan II
$35-3154.84 -
Cosyntropin
$71.8-1360
Suppliers and manufacturers
Shaanxi TNJONE Pharmaceutical Co., Ltd
Teriparatide acetate
CAS:52232-67-4
Shandong Huisheng Import & Export Co., Ltd.
Cellmano Biotech Limited
Rixing Chemical CO.,LTD.
Yiwu Fengjin Commercial Company
HUARONG(GUANGDONG) PHARMACEUTICAL CO.,LTD
Hydebio Labs Co.,Limited
Teriparatide acetate
CAS:52232-67-4




