CRB1000985
CRF human, rat
The peptide CRF, also known as the Corticotropin Releasing Factor is a 14 amino acid neuropeptide which is produced by the hypothalamus, within the hypothalamic-pituitary adrenal axis in response to stress stimuli. The CRF family exert their fun... Read More
Different Quantity or Specification Required?
Add Favourite
Bulk & Custom RFQ
Update on Shipping Rates — Effective May, 2026
There is no hazardous surcharge associated with this product
There is no packaging charge associated with this product
Strictly for Research Purposes only. Not for Personal or Veterinary use.
Synonyms
H-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-amide
H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-As p-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Gl
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-amide
H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-As p-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Gl
Product Code
CRB1000985
Molecular Weight
4,754.5 g/mol
Long Term Storage
store at <-15°C
Storage
store at <-15°C
Precautionary Statement Code
P261, P262
Harmonized Tariff Codes
Switzerland: 29337900 -
USA: 2933798500 -
Slovakia: 2933790090 -
UK: 2933790090 -
China: 2933790099
The peptide CRF, also known as the Corticotropin Releasing Factor is a 14 amino acid neuropeptide which is produced by the hypothalamus, within the hypothalamic-pituitary adrenal axis in response to stress stimuli. The CRF family exert their function by binding to Corticotropin-releasing factor receptors 1 and 2. During stress the production of CRF stimulates downstream hormones such as glucocorticoids and adrenocorticotropin (ACTH) through binding to CRF1 in the anterior pituitary gland. A negative feedback look is generated through glucocorticoids thus preventing the further release of CRF from the hypothalamus.
Studies have shown CRF to be overproduced in patients with depression and can contribute to symptoms such as, reduced quality of sleep, anxiety, reduced appetite and analgesia. Furthermore higher CRF levels has been associated with immune cell dysfunction through preventing T-cell proliferation.
Studies have shown CRF to be overproduced in patients with depression and can contribute to symptoms such as, reduced quality of sleep, anxiety, reduced appetite and analgesia. Furthermore higher CRF levels has been associated with immune cell dysfunction through preventing T-cell proliferation.
Reviews for CRF human, rat CRB1000985
Review this product
Earn BioPoints by writing a review for one of our products.
You must be logged in to write a review
Login
Average Rating: 0
(Based on 0 Reviews)
5 Star
0%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%
